Proteintech, 21668-1-AP, SESN1 Polyclonal antibody

Size: 20ul / 150ul The SESN1 (21668-1-AP) by Proteintech is a Polyclonal antibody targeting SESN1 in WB, ELISA applications with reactivity to human, mouse, rat samples 21668-1-AP targets SESN1 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: human skeletal muscle tissue, HEK-293 cells, mouse liver tissue, human testis tissue, HeLa cells, K-562 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Background Information Sestrins, including sestrin-1 (PA26), sestrin-2 (Hi95), and sestrin-3, are 48 to 65 kDa cystein sulfinyl reductases and they modulate peroxide signaling and antioxidant defense. These proteins selectively reduce or repair hyperoxidized forms of typical 2-Cys peroxiredoxins within eukaryotes. Expression of these proteins is regulated by p53, a tumor suppressor protein. Sestrin 1 is implicated in the inhibition of cell growth. It is approximately a 66kDa protein in humans (551 amino acids). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag16462 Product name: Recombinant human SESN1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-141 aa of BC112036 Sequence: MAEGENEVRWDGLCSRDSTTRETALENIRQTILRKTEYLRSVKETPHRPSDGLSNTESSDGLNKLLAHLLMLSKRCPFKDVREKSEFILKSIQELGIRIPRPLGQGPSRFIPEKEILQVGSEDAQMHALFADSFAALGRLD Predict reactive species Full Name: sestrin 1 Calculated Molecular Weight: 551 aa, 64 kDa Observed Molecular Weight: 66-68 kDa GenBank Accession Number: BC112036 Gene Symbol: SESN1 Gene ID (NCBI): 27244 RRID: AB_10793724 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9Y6P5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.