Product Description
Size: 20ul / 150ul
The SYNGR4 (21751-1-AP) by Proteintech is a Polyclonal antibody targeting SYNGR4 in WB, ELISA applications with reactivity to human samples
21751-1-AP targets SYNGR4 in WB, ELISA applications and shows reactivity with human samples.
Tested Applications
Positive WB detected in: human brain tissue, HepG2 cells
Recommended dilution
Western Blot (WB): WB : 1:500-1:3000
Specification
Tested Reactivity: human
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag15865 Product name: Recombinant human SYNGR4 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 155-234 aa of BC106891 Sequence: LVWIFQAYLAFQDLRNDAPVPYKRFLDEGGMVLTTLPLPSANSPVNMPTTGPNSLSYASSALSPCLTAPKSPRLAMMPDN Predict reactive species
Full Name: synaptogyrin 4
Calculated Molecular Weight: 234 aa, 26 kDa
Observed Molecular Weight: 31-35 kDa
GenBank Accession Number: BC106891
Gene Symbol: SYNGR4
Gene ID (NCBI): 23546
RRID: AB_10860264
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: O95473
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924