Proteintech, 21762-1-AP, EPHB1 Polyclonal antibody

Size: 20ul / 150ul The EPHB1 (21762-1-AP) by Proteintech is a Polyclonal antibody targeting EPHB1 in WB, ELISA applications with reactivity to human, mouse, rat samples 21762-1-AP targets EPHB1 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: SH-SY5Y cells, SK-N-SH cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information EPHB1, also named as EPHT2, NET, HEK6 and ELK, belongs to the protein kinase superfamily, Tyr protein kinase family, and Ephrin receptor subfamily. It is a receptor for members of the ephrin-B family. EPHB1 binds to ephrin-B1, -B2 and -B3. EPHB1 may be involved in cell-cell interactions in the nervous system. EPHB1 catalyzes the reaction: ATP + a [protein]-L-tyrosine = ADP + a [protein]-L-tyrosine phosphate. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag16347 Product name: Recombinant human EPHB1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 247-371 aa of BC111744 Sequence: MVPIGRCTCKPGYEPENSVACKACPAGTFKASQEAEGCSHCPSNSRSPAEASPICTCRTGYYRADFDPPEVACTSVPSGPRNVISIVNETSIILEWHPPRETGGRDDVTYNIICKKCRADRRSCS Predict reactive species Full Name: EPH receptor B1 Calculated Molecular Weight: 984 aa, 110 kDa Observed Molecular Weight: 110-120 kDa GenBank Accession Number: BC111744 Gene Symbol: EPHB1 Gene ID (NCBI): 2047 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P54762 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.