Proteintech, 21765-1-AP, FFAR2 Polyclonal antibody

Size: 20ul / 150ul The FFAR2 (21765-1-AP) by Proteintech is a Polyclonal antibody targeting FFAR2 in WB, ELISA applications with reactivity to human, mouse samples 21765-1-AP targets FFAR2 in WB, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse colon tissue Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Background Information Free fatty acid receptors (FFAR) play significant roles in various physiological processes through interaction with their ligands, fatty acids. Free fatty acid receptor 2 (FFAR2, also known as FFA2 or GPR43) is a receptor for short-chain fatty acids (SCFAs) and plays a role in the regulation of whole-body energy homeostasis and intestinal immunity (PMID: 12684041). It has been considered a therapeutic target for metabolic and inflammatory conditions (PMID: 23589301). FFAR2 has a calculated molecular weight of 37 kDa and can be glycosylated. The higher apparent molecular weight of 50 kDa has been reported, probably due to glycosylation (PMID: 31707282; 28131568). Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag16367 Product name: Recombinant human FFAR2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 270-330 aa of BC096198 Sequence: PLLFYFSSSVVRRAFGRGLQVLRNQGSSLLGRRGKDTAEGTNEDRGVGQGEGMPSSDFTTE Predict reactive species Full Name: free fatty acid receptor 2 Calculated Molecular Weight: 330 aa, 37 kDa Observed Molecular Weight: 37-50 kDa GenBank Accession Number: BC096198 Gene Symbol: FFAR2 Gene ID (NCBI): 2867 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O15552 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.