Proteintech, 21799-1-AP, LDHA Polyclonal antibody

Size: 20ul / 150ul The LDHA (21799-1-AP) by Proteintech is a Polyclonal antibody targeting LDHA in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples 21799-1-AP targets LDHA in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HEK-293 cells, MCF-7 cells, human testis tissue, A375 cells, HepG2 cells, NIH/3T3 cells, MDA-MB-231 cells, mouse kidney tissue, rat kidney tissue Positive IP detected in: HEK-293 cells Positive IHC detected in: human skeletal muscle tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:30000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:20-1:200 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information Lactate dehydrogenase (LDH) is composed of A subunits predominate in skeletal muscle and B subunits are abundantly produced in brain and heart. The LDHA (lactate dehydrogenase A) and COPB1 (coatomer protein complex, subunit beta 1)genes, are involved in energy metabolism and protein transport processes. Both genes might play important roles in muscle development. It has some isoforms with the molecular mass of 27-40 kDa and can form a homotetramer(PMID:11276087). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat, pig, monkey Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag16703 Product name: Recombinant human LDHA protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 283-332 aa of BC067223 Sequence: IKDDVFLSVPCILGQNGISDLVKVTLTSEEEARLKKSADTLWGIQKELQF Predict reactive species Full Name: lactate dehydrogenase A Calculated Molecular Weight: 332 aa, 37 kDa Observed Molecular Weight: 32-37 kDa GenBank Accession Number: BC067223 Gene Symbol: LDHA Gene ID (NCBI): 3939 RRID: AB_10858925 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P00338 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.