Proteintech, 21928-1-AP, CHRNG Polyclonal antibody

Size: 20ul / 150ul The CHRNG (21928-1-AP) by Proteintech is a Polyclonal antibody targeting CHRNG in WB, ELISA applications with reactivity to human samples 21928-1-AP targets CHRNG in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, HepG2 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Background Information Acetylcholine receptor subunit gamma is a protein that in humans is encoded by the CHRNG gene. The mammalian muscle-type acetylcholine receptor is a transmembrane pentameric glycoprotein with two alpha subunits, one beta, one delta, and one epsilon (in adult skeletal muscle) or gamma (in fetal and denervated muscle) subunit. This gene, which encodes the gamma subunit, is expressed prior to the thirty-third week of gestation in humans. The gamma subunit of the acetylcholine receptor plays a role in neuromuscular organogenesis and ligand binding and disruption of gamma subunit expression prevents the correct localization of the receptor in cell membranes. Mutations in this gene cause Escobar syndrome and a lethal form of multiple pterygium syndrome. Muscle-type acetylcholine receptor is the major antigen in the autoimmune disease myasthenia gravis. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag16505 Product name: Recombinant human CHRNG protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 279-422 aa of BC111802 Sequence: LRSPHTHSMARGVRKVFLRLLPQLLRMHVRPLAPAAVQDTQSRLQNGSSGWSITTGEEVALCLPRSELLFQQWQRQGLVAAALEKLEKGPELGLSQFCGSLKQAAPAIQACVEACNLIACARHQQSHFDNGNEEWFLVGRVLDR Predict reactive species Full Name: cholinergic receptor, nicotinic, gamma Calculated Molecular Weight: 465 aa, 52 kDa Observed Molecular Weight: 58 kDa GenBank Accession Number: BC111802 Gene Symbol: CHRNG Gene ID (NCBI): 1146 RRID: AB_3085678 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P07510 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.