Proteintech, 21934-1-AP, ZIK1 Polyclonal antibody

Size: 20ul / 150ul The ZIK1 (21934-1-AP) by Proteintech is a Polyclonal antibody targeting ZIK1 in WB, IP, ELISA applications with reactivity to human samples 21934-1-AP targets ZIK1 in WB, IP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: Jurkat cells Positive IP detected in: Jurkat cells Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag16568 Product name: Recombinant human ZIK1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 62-243 aa of BC103958 Sequence: LVASLGCGHGTEDEETPSDQNVSVGVSQSKAGSSTQKTQSCEMCVPVLKDILHLADLPGQKPYLVGECTNHHQHQKHHSAKKSLKRDMDRASYVKCCLFCMSLKPFRKWEVGKDLPAMLRLLRSLVFPGGKKPGTITECGEDIRSQKSHYKSGECGKASRHKHTPVYHPRVYTGKKLYECSK Predict reactive species Full Name: zinc finger protein interacting with K protein 1 homolog (mouse) Calculated Molecular Weight: 487 aa, 55 kDa Observed Molecular Weight: 50-55 kDa GenBank Accession Number: BC103958 Gene Symbol: ZIK1 Gene ID (NCBI): 284307 RRID: AB_2878948 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q3SY52 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.