Proteintech, 21945-1-AP, TOR1B Polyclonal antibody

Size: 20ul / 150ul The TOR1B (21945-1-AP) by Proteintech is a Polyclonal antibody targeting TOR1B in WB, ELISA applications with reactivity to human, mouse, rat samples 21945-1-AP targets TOR1B in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse heart tissue, rat heart tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information Torsin A is 1 of 4 predicted mammalian torsin ATPases associated with assorted cellular activities (AAA+) proteins (PMID: 20015956). TOR1B (torsin family 1 member B), also called TorsinB (TorB), is similar to TorsinA at the sequence level. TorsinA and TorsinB are both ubiquitously expressed in all cell types though TorsinA is more highly expressed in neurons. TorsinA and TorsinB may be somewhat functionally redundant, with TorsinA being more important in neuronal cells and TorsinB being more important in other tissues (PMID: 24275647). TOR1B serve as a molecular chaperone assisting in the proper folding of secreted and/or membrane proteins,and plays a role in non-neural cells nuclear envelope and endoplasmic reticulum integrity (PMID: 24275647; 23569223). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag16641 Product name: Recombinant human TOR1B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 25-77 aa of BC015578 Sequence: FEPITVGLAIGAASAITGYLSYNDIYCRFAECCREERPLNASALKLDLEEKLF Predict reactive species Full Name: torsin family 1, member B (torsin B) Calculated Molecular Weight: 336 aa, 38 kDa Observed Molecular Weight: 34 kDa GenBank Accession Number: BC015578 Gene Symbol: TOR1B Gene ID (NCBI): 27348 RRID: AB_3669382 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O14657 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.