Proteintech, 22013-1-AP, SLC26A5 Polyclonal antibody

Size: 20ul / 150ul The SLC26A5 (22013-1-AP) by Proteintech is a Polyclonal antibody targeting SLC26A5 in WB, ELISA applications with reactivity to human, mouse, rat samples 22013-1-AP targets SLC26A5 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, mouse heart tissue, rat brain tissue, rat heart tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information SLC26A5 (Prestin) is a protein that is housed in abundance within the lateral membrane of outer hair cells (OHC) in the organ of Corti. The protein imparts robust electromechanical activity to the cell that is unlike any other form of cellular motility, notably associated with a voltage-dependent, bell-shaped nonlinear capacitance (NLC) that reports on conformational changes in the protein (PMID: 32061780). SLC26A5 is responsible for acute sensitivity and frequency selectivity in the vertebrate auditory system (PMID: 34294052). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag16631 Product name: Recombinant human SLC26A5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-86 aa of BC100832 Sequence: MDHAEENEILAATQRYYVERPIFSHPVLQERLHTKDKVPDSIADKLKQAFTCTPKKIRNIIYMFLPITKWLPAYKFKEYVLGDLVS Predict reactive species Full Name: solute carrier family 26, member 5 (prestin) Calculated Molecular Weight: 744 aa, 81 kDa Observed Molecular Weight: 70 kDa GenBank Accession Number: BC100832 Gene Symbol: SLC26A5 Gene ID (NCBI): 375611 RRID: AB_3669384 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P58743 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.