Proteintech, 22023-1-AP, NFATC2 Polyclonal antibody

Size: 20ul / 150ul The NFATC2 (22023-1-AP) by Proteintech is a Polyclonal antibody targeting NFATC2 in WB, IHC, IF/ICC, FC (Intra), IP, ELISA applications with reactivity to human, mouse samples 22023-1-AP targets NFATC2 in WB, IHC, IF/ICC, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: Jurkat cells Positive IP detected in: Jurkat cells Positive IHC detected in: human breast cancer tissue, human colon cancer tissue, human lymphoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: U-251 cells Positive FC (Intra) detected in: Jurkat cells Recommended dilution Western Blot (WB): WB : 1:2000-1:16000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension Background Information Nuclear factor of activated T-cells, cytoplasmic 2 (NFATC2), also named NFAT1, or NFATP, is a 925 amino acid protein, which is expressed in thymus, spleen, heart, testis, brain, placenta, muscle and pancreas. Cytoplasmic for the phosphorylated form and nuclear after activation that is controlled by calcineurin-mediated dephosphorylation. Rapid nuclear exit of NFATC is thought to be one mechanism by which cells distinguish between sustained and transient calcium signals. The subcellular localization of NFATC plays a key role in the regulation of gene transcription. NFATC2 plays a role in the inducible expression of cytokine genes in T-cells, especially in the induction of the IL-2, IL-3, IL-4, TNF-alpha or GM-CSF. NFATC2 promotes invasive migration through the activation of GPC6 expression and WNT5A signaling pathway. The calculated molecular weight of NFATC2 is about 97-100 kDa, but the modified NFATC2 protein is about 135 kDa. Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag16849 Product name: Recombinant human NFATC2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-302 aa of BC136418 Sequence: MNAPERQPQPDGGDAPGHEPGGSPQDELDFSILFDYEYLNPNEEEPNAHKVASPPSGPAYPDDVLDYGLKPYSPLASLSGEPPGRFGEPDRVGPQKFLSAAKPAGASGLSPRIEITPSHELIQAVGPLRMRDAGLLVEQPPLAGVAASPRFTLPVPGFEGYREPLCLSPASSGSSASFISDTFSPYTSPCVSPNNGGPDDLCPQFQNIPAHYSPRTSPIMSPRTSLAEDSCLGRHSPVPRPASRSSSPGAKRRHSCAEALVALPPGASPQRSRSPSPQPSSHVAPQDHGSPAGYPPVAGSAV Predict reactive species Full Name: nuclear factor of activated T-cells, cytoplasmic, calcineurin-dependent 2 Calculated Molecular Weight: 925 aa, 100 kDa Observed Molecular Weight: 135 kDa GenBank Accession Number: BC136418 Gene Symbol: NFATC2 Gene ID (NCBI): 4773 RRID: AB_2878973 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q13469 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.