Proteintech, 22106-1-AP, FAM167A Polyclonal antibody

Size: 20ul / 150ul The FAM167A (22106-1-AP) by Proteintech is a Polyclonal antibody targeting FAM167A in WB, ELISA applications with reactivity to human samples 22106-1-AP targets FAM167A in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: U-87 MG cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Background Information Family with sequence similarity 167, member A (FAM167A) has ubiquitously low expression in all tissues types throughout the body. In mouse it has a higher expression in the skin, B-cells, and spleen, but the same low expression in all other cell types. It's reported that FAM167A acts as an essential factor for BCR-ABL-independent TKI resistance in CML by activating the noncanonical NF-κB pathway.(PMID: 35241148) Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag17336 Product name: Recombinant human FAM167A protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 48-214 aa of BC104041 Sequence: EWQARLEEQTWPFPRPAAEPQASLEEGERGGQEPLLPLREAGQHPPSARSASQGARPLSTGKLEGFQSIDEAIAWLRKELTEMRLQDQQLARQLMRLRGDINKLKIEHTCRLHRRMLNDATYELEERDELADLFCDSPLASSFSLSTPLKLIGVTKMNINSRRFSLC Predict reactive species Full Name: family with sequence similarity 167, member A Calculated Molecular Weight: 214 aa, 24 kDa Observed Molecular Weight: 25 kDa GenBank Accession Number: BC104041 Gene Symbol: FAM167A Gene ID (NCBI): 83648 RRID: AB_3669387 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96KS9 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.