Proteintech, 22114-1-AP, JUN Polyclonal antibody

Size: 20ul / 150ul The JUN (22114-1-AP) by Proteintech is a Polyclonal antibody targeting JUN in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat, monkey samples 22114-1-AP targets JUN in WB, IHC, IF/ICC, ChIP, ELISA applications and shows reactivity with human, mouse, rat, monkey samples. Tested Applications Positive WB detected in: NIH/3T3 cells, rat brain tissue, HEK-293 cells Positive IHC detected in: human skin cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: NIH/3T3 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information JUN is also named as c-Jun and AP1, belongs to the bZIP family and Jun subfamily. JUN, the most extensively studied protein of the activator protein-1 (AP-1) complex, is involved in numerous cell activities, such as proliferation, apoptosis, survival, tumorigenesis and tissue morphogenesis (PMID: 22180088). JUN is a transcription factor that recognizes and binds to the enhancer heptamer motif 5'-TGA[CG]TCA-3'. It promotes activity of NR5A1 when phosphorylated by HIPK3 leading to increased steroidogenic gene expression upon cAMP signaling pathway stimulation. JUN is a basic leucine zipper (bZIP) transcription factor that acts as homo- or heterodimer, binding to DNA and regulating gene transcription (PMID: 9732876). In additon, extracellular signals can induce post-translational modifications of JUN, resulting in altered transcriptional activity and target gene expression (PMID:8464713). More over, it has uncovered multiple layers of a complex regulatory scheme in which JUN is able to crosstalk, amplify and integrate different signals for tissue development and disease. Jun is predominantly nuclear, ubiquitinated Jun colocalizes with lysosomal proteins (PMID: 15469925). This antibody is a rabbit polyclonal antibody raised against a region of human JUN. Both phosphorylated (p-c-Jun) and unphosphorylated forms of c-Jun, with sizes of 42-45 kDa and 36-39 kDa, respectively are obtain in some experiments (PMID:17210646). Specification Tested Reactivity: human, mouse, rat, monkey Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag17419 Product name: Recombinant human AP1,JUN,P39 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-331 aa of BC002646 Sequence: MTAKMETTFYDDALNASFLPSESGPYGYSNPKILKQSMTLNLADPVGSLKPHLRAKNSDLLTSPDVGLLKLASPELERLIIQSSNGHITTTPTPTQFLCPKNVTDEQEGFAEGFVRALAELHSQNTLPSVTSAAQPVNGAGMVAPAVASVAGGSGSGGFSASLHSEPPVYANLSNFNPGALSSGGGAPSYGAAGLAFPAQPQQQQQPPHHLPQQMPVQHPRLQALKEEPQTVPEMPGETPPLSPIDMESQERIKAERKRMRNRIAASKCRKRKLERIARLEEKVKTLKAQNSELASTANMLREQVAQLKQKVMNHVNSGCQLMLTQQLQTF Predict reactive species Full Name: jun oncogene Calculated Molecular Weight: 331 aa, 36 kDa Observed Molecular Weight: 40-46 kDa GenBank Accession Number: BC002646 Gene Symbol: JUN Gene ID (NCBI): 3725 RRID: AB_2750860 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P05412 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.