Proteintech, 22205-1-AP, Desmin Polyclonal antibody

Size: 20ul / 150ul The Desmin (22205-1-AP) by Proteintech is a Polyclonal antibody targeting Desmin in WB, ELISA applications with reactivity to human, mouse, rat samples 22205-1-AP targets Desmin in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse heart tissue, mouse skeletal muscle tissue Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Background Information Desmin is the main intermediate filament protein in skeletal and cardiac muscle cells and is essential for both the structural integrity and the survival of muscle cells. As an abundant muscle-specific protein, desmin has been widely used as a marker of muscle derived tumors. Anti-desmin is also valuable in the differential diagnosis of tumors of uncertain origin. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag17525 Product name: Recombinant human DES protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-91 aa of BC032116 Sequence: MSQAYSSSQRVSSYRRTFGGAPGFPLGSPLSSPVFPRAGFGSKGSSSSVTSRVYQVSRTSGGAGGLGSLRASRLGTTRTPSSYGAGELLDF Predict reactive species Full Name: desmin Calculated Molecular Weight: 470 aa, 54 kDa Observed Molecular Weight: 50-55 kDa GenBank Accession Number: BC032116 Gene Symbol: Desmin Gene ID (NCBI): 1674 RRID: AB_2879027 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P17661 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.