Iright
BRAND / VENDOR: Proteintech

Proteintech, 22241-1-AP, CA5A Polyclonal antibody

CATALOG NUMBER: 22241-1-AP
السعر العادي$0.99
/
  • ddddd

    99 xxxxxx

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The CA5A (22241-1-AP) by Proteintech is a Polyclonal antibody targeting CA5A in IF/ICC, ELISA applications with reactivity to human samples 22241-1-AP targets CA5A in IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive IF/ICC detected in: HeLa cells Recommended dilution Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag17689 Product name: Recombinant human CA5A protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 77-126 aa of BC137411 Sequence: DPQLKPLRVSYEAASCLYIWNTGYLFQVEFDDATEASGISGGPLENHYRL Predict reactive species Full Name: carbonic anhydrase VA, mitochondrial Calculated Molecular Weight: 305 aa, 35 kDa GenBank Accession Number: BC137411 Gene Symbol: CA5A Gene ID (NCBI): 763 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P35218 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924