Proteintech, 22241-1-AP, CA5A Polyclonal antibody

Size: 20ul / 150ul The CA5A (22241-1-AP) by Proteintech is a Polyclonal antibody targeting CA5A in IF/ICC, ELISA applications with reactivity to human samples 22241-1-AP targets CA5A in IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive IF/ICC detected in: HeLa cells Recommended dilution Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag17689 Product name: Recombinant human CA5A protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 77-126 aa of BC137411 Sequence: DPQLKPLRVSYEAASCLYIWNTGYLFQVEFDDATEASGISGGPLENHYRL Predict reactive species Full Name: carbonic anhydrase VA, mitochondrial Calculated Molecular Weight: 305 aa, 35 kDa GenBank Accession Number: BC137411 Gene Symbol: CA5A Gene ID (NCBI): 763 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P35218 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.