Proteintech, 22335-1-AP, RCC1 Polyclonal antibody

Size: 20ul / 150ul The RCC1 (22335-1-AP) by Proteintech is a Polyclonal antibody targeting RCC1 in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples 22335-1-AP targets RCC1 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: SH-SY5Y cells, HepG2 cells, mouse colon tissue, rat colon tissue Positive IP detected in: HeLa cells Positive IHC detected in: mouse testis tissue, human small intestine tissue, human testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:5000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:20-1:200 Background Information CHC1, also named as RCC1, promotes the exchange of ran-bound gdp by gtp. It is involved in the regulation of onset of chromosome condensation in the S-phase. Phosphorylation of RCC1 on serines located in or near its nuclear localization signal activates RCC1 to generate RanGTP on mitotic chromosomes, which is required for spindle assembly and chromosome segregation. This antibody is a rabbit polyclonal antibody raised against full length RCC1 of human origin. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag17809 Product name: Recombinant human RCC1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-421 aa of BC010067 Sequence: MSPKRIAKRRSPPADAIPKSKKVKVSHRSHSTEPGLVLTLGQGDVGQLGLGENVMERKKPALVSIPEDVVQAEAGGMHTVCLSKSGQVYSFGCNDEGALGRDTSVEGSEMVPGKVELQEKVVQVSAGDSHTAALTDDGRVFLWGSFRDNNGVIGLLEPMKKSMVPVQVQLDVPVVKVASGNDHLVMLTADGDLYTLGCGEQGQLGRVPELFANRGGRQGLERLLVPKCVMLKSRGSRGHVRFQDAFCGAYFTFAISHEGHVYGFGLSNYHQLGTPGTESCFIPQNLTSFKNSTKSWVGFSGGQHHTVCMDSEGKAYSLGRAEYGRLGLGEGAEEKSIPTLISRLPAVSSVACGASVGYAVTKDGRVFAWGMGTNYQLGTGQDEDAWSPVEMMGKQLENRVVLSVSSGGQHTVLLVKDKEQS Predict reactive species Full Name: regulator of chromosome condensation 1 Calculated Molecular Weight: 421 aa, 45 kDa Observed Molecular Weight: 45-50 kDa GenBank Accession Number: BC010067 Gene Symbol: RCC1 Gene ID (NCBI): 1104 RRID: AB_10896498 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P18754 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.