Proteintech, 22551-1-AP, RFX6 Polyclonal antibody

Size: 20ul / 150ul The RFX6 (22551-1-AP) by Proteintech is a Polyclonal antibody targeting RFX6 in WB, ELISA applications with reactivity to human samples 22551-1-AP targets RFX6 in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: Caco-2 cells Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Background Information The RFX proteins represent an essential class II transcription factor family that share several conserved regions, including a centrally located DNA-binding domain (DBD) and a C-terminal D region that facilitates dimerization. RFX6, also known as RFXDC1, is a 928 amino acid nuclear protein that, via interactions with other RFX proteins, can bind DNA and is thought to activate the transcription of target genes. RFX6 is specifically expressed in pancreas, small intestine and colon. Mutations in the gene encoding RFX6 is the cause of the Mitchell-Riley syndrome (MIRIS), which is characterized by neonatal diabetes, duodenal and jejunal atresia, a hypoplastic or annular pancreas and absent gallbladder. Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag18235 Product name: Recombinant human RFX6 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 586-928 aa of BC039248 Sequence: SDAVKNESHVETTYLPLPSSQPGGLGPALHQFPAGNTDNMPLTGQMELSQIAGHLMTPPISPAMASRGSVINQGPMAGRPPSVGPVLSAPSHCSTYPEPIYPALPQANHDFYSTSSNYQTVFRAQPHSTSGLYPHHTEHGRCMAWTEQQLSRDFFSGSCAGSPYNSRPPSSYGPSLQAQDSHNMQFLNTGSFNFLSNTGAASCQGATLPPNSPNGYYGSNINYPESHRLGSMVNQHVSVISSIRSLPPYSDIHDPLNILDDSGRKQTSSFYTDTSSPVACRTPVLASSLQTPIPSSSSQCMYGTSNQYPAQETLDSHGTSSREMVSSLPPINTVFMGTAAGGT Predict reactive species Full Name: regulatory factor X, 6 Calculated Molecular Weight: 928 aa, 102 kDa Observed Molecular Weight: 102 kDa GenBank Accession Number: BC039248 Gene Symbol: RFX6 Gene ID (NCBI): 222546 RRID: AB_2879120 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8HWS3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.