Proteintech, 22556-1-AP, FTSJ2 Polyclonal antibody

Size: 20ul / 150ul The FTSJ2 (22556-1-AP) by Proteintech is a Polyclonal antibody targeting FTSJ2 in WB, IP, ELISA applications with reactivity to human, mouse samples 22556-1-AP targets FTSJ2 in WB, IP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: human skeletal muscle tissue, human placenta tissue Positive IP detected in: mouse skeletal muscle tissue Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Background Information Putative ribosomal RNA methyltransferase 2 (FTSJ2), also named as FJH1 or Protein FTSJ homolog 2 is a 246 amino acid protein, which belongs to the methyl-transferase superfamily. FTSJ2 localizes in the nucleus and is widely expressed in in muscle, placenta, and heart. FTSJ2 functions as a nucleolar RNA methyl-transferase involved in eukaryotic RNA processing and modification. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag18410 Product name: Recombinant human FTSJ2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-246 aa of BC114514 Sequence: MAGYLKLVCVSFQRQGFHTVGSRCKNRTGAEHLWLTRHLRDPFVKAAKVESYRCRSAFKLLEVNERHQILRPSLRVLDCGAAPGAWSQVAVQKVNAAGTDPSSPVGFVLGVDLLHIFPLEGATFLCPADVTDPRTSQRILEVLPGRRADVILSDMAPNATGFRDLDHDRLISLCLTLLSVTPDILQPGGTFLCKTWAGSQSRRLQRRLTEEFQNVRIIKPEASRKESSEVYFLATQYHGRKGTVKQ Predict reactive species Full Name: FtsJ homolog 2 (E. coli) Calculated Molecular Weight: 246 aa, 27 kDa Observed Molecular Weight: 29 kDa GenBank Accession Number: BC114514 Gene Symbol: FTSJ2 Gene ID (NCBI): 29960 RRID: AB_2879122 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen Affinity purified UNIPROT ID: Q9UI43 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.