Proteintech, 22670-1-AP, A4GNT Polyclonal antibody

Size: 20ul / 150ul The A4GNT (22670-1-AP) by Proteintech is a Polyclonal antibody targeting A4GNT in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 22670-1-AP targets A4GNT in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: K-562 cells, mouse pancreas tissue, mouse stomach tissue, rat stomach tissue, L02 cells Positive IHC detected in: human stomach cancer tissue, human pancreas cancer tissue, rat stomach tissue, mouse stomach tissue, human stomach tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information A4GNT (alpha-1,4-N-acetylglucosaminyltransferase) catalyzes the transfer of N-acetylglucosamine (GlcNAc) to core 2 branched O-glycans, forming a unique glycan structure, GlcNAcalpha1-->4Galbeta-->R. The gene is expressed with a bias in certain tissues, particularly in the stomach (RPKM 9.5) and duodenum (RPKM 0.9). Alpha4GnT has been implicated in O-glycan biosynthesis and is thought to have a role in preventing gastric cancer by inhibiting Helicobacter pylori infection and suppressing tumor-promoting inflammation. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag18432 Product name: Recombinant human A4GNT protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 76-340 aa of BC119639 Sequence: KIYPEWPVVFFMKGLTDSTPMPSNSTYPAFSFLSAIDNVFLFPLDMKRLLEDTPLFSWYNQINASAERNWLHISSDASRLAIIWKYGGIYMDTDVISIRPIPEENFLAAQASRYSSNGIFGFLPHHPFLWECMENFVEHYNSDIWGNQGPELMTRMLRVWCKLEDFQEVSDLRCLNISFLHPQRFYPISYREWRRYYEVWDTEPSFNVSYALHLWNHMNQEGRAVIRGSNTLVENLYRKHCPRTYRDLIKGPEGSVTGELGPGNK Predict reactive species Full Name: alpha-1,4-N-acetylglucosaminyltransferase Calculated Molecular Weight: 340 aa, 39 kDa Observed Molecular Weight: 34-37 kDa GenBank Accession Number: BC119639 Gene Symbol: A4GNT Gene ID (NCBI): 51146 RRID: AB_11183768 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9UNA3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.