Proteintech, 22697-1-AP, DOK7 Polyclonal antibody

Size: 20ul / 150ul The DOK7 (22697-1-AP) by Proteintech is a Polyclonal antibody targeting DOK7 in WB, IHC, ELISA applications with reactivity to human samples 22697-1-AP targets DOK7 in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: Jurkat cells, MCF-7 cells, HEK-293 cells Positive IHC detected in: human skeletal muscle tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Background Information DOK7, also named as C4orf25, is a MuSK-interacting cytoplasmic protein. DOK7 is essential for neuromuscular synaptogenesis through its interaction with MuSK. It plays an essential role in neuromuscular synaptogenesis. DOK7 acts in aneural activation of MUSK and subsequent acetylcholine receptor (AchR) clustering in myotubes. DOK7 has some isoforms with MW 53 kDa, 37 kDa, 28 kDa and 64 kDa. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag18543 Product name: Recombinant human DOK7 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 136-504 aa of BC131544 Sequence: DVLVLARDIPPAVTGQWKLSDLRRYGAVPSGFIFEGGTRCGYWAGVFFLSSAEGEQISFLFDCIVRGISPTKGPFGLRPVLPDPSPPGPSTVEERVAQEALETLQLEKRLSLLSHAGRPGSGGDDRSLSSSSSEASHLDVSASSRLTAWPEQSSSSASTSQEGPRPAAAQAAGEAMVGASRPPPKPLRPRQLQEVGRQSSSDSGIATGSHSSYSSSLSSYAGSSLDVWRATDELGSLLSLPAAGAPEPSLCTCLPGTVEYQVPTSLRAHYDTPRSLCLAPRDHSPPSQGSPGNSAARDSGGQTSAGCPSGWLGTRRRGLVMEAPQDSEATLPGPAPGEPWEAGGPHAGPPPAFFSACPVCGGLKVNPPP Predict reactive species Full Name: docking protein 7 Calculated Molecular Weight: 504 aa, 53 kDa Observed Molecular Weight: 64 kDa GenBank Accession Number: BC131544 Gene Symbol: DOK7 Gene ID (NCBI): 285489 RRID: AB_2879152 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q18PE1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.