Proteintech, 22726-1-AP, SLC26A4 Polyclonal antibody

Size: 20ul / 150ul The SLC26A4 (22726-1-AP) by Proteintech is a Polyclonal antibody targeting SLC26A4 in WB, IHC, IP, ELISA applications with reactivity to human samples 22726-1-AP targets SLC26A4 in WB, IHC, IP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: 37°C incubated A549 cells Positive IP detected in: mouse kidney tissue Positive IHC detected in: mouse kidney tissue, mouse lung tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag18622 Product name: Recombinant human SLC26A4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 517-646 aa of BC153002 Sequence: SWNGLGSIPSTDIYKSTKNYKNIEEPQGVKILRFSSPIFYGNVDGFKKCIKSTVGFDAIRVYNKRLKALRKIQKLIKSGQLRATKNGIISDAVSTNNAFEPDEDIEDLEELDIPTKEIEIQVDWNSELPV Predict reactive species Full Name: solute carrier family 26, member 4 Calculated Molecular Weight: 780 aa, 86 kDa Observed Molecular Weight: 90 kDa GenBank Accession Number: BC153002 Gene Symbol: SLC26A4 Gene ID (NCBI): 5172 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O43511 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.