Proteintech, 22861-1-AP, IL-22RA2 Polyclonal antibody

Size: 20ul / 150ul The IL-22RA2 (22861-1-AP) by Proteintech is a Polyclonal antibody targeting IL-22RA2 in WB, IHC, ELISA applications with reactivity to human samples 22861-1-AP targets IL-22RA2 in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: MDA-MB-453s cells Positive IHC detected in: human lung cancer tissue, human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information Interleukin-22 receptor subunit alpha-2 (IL22RA2, also known as CRF2-10) is a soluble member of the type II cytokine receptor family. Through binding to IL22, IL22RA2 prevents the interaction of IL22 with the functional IL22-R complex and blocks the activity of IL22 (in vitro). IL22RA2 may play an important role as an IL22 antagonist in the regulation of inflammatory responses. It has been described that human IL22RA2 gene encodes three alternatively spliced isoforms called CRF2-10L, CRF2-10, and CRF2-10s, with molecular weights of 31 kDa, 27 kDa, and 15 kDa, respectively. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag18854 Product name: Recombinant human IL-22RA2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-232 aa of BC125167 Sequence: MMPKHCFLGFLISFFLTGVAGTQSTHESLKPQRVQFQSRNFHNILQWQPGRALTGNSSVYFVQYKIYGQRQWKNKEDCWGTQELSCDLTSETSDIQEPYYGRVRAASAGSYSEWSMTPRFTPWWETKIDPPVMNITQVNGSLLVILHAPNLPYRYQKEKNVSIEDYYELLYRVFIINNSLEKEQKVYEGAHRAVEIEALTPHSSYCVVAEIYQPMLDRRSQRSEERCVEIP Predict reactive species Full Name: interleukin 22 receptor, alpha 2 Calculated Molecular Weight: 263 aa, 31 kDa Observed Molecular Weight: 27 kDa GenBank Accession Number: BC125167 Gene Symbol: IL-22RA2 Gene ID (NCBI): 116379 RRID: AB_2879180 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q969J5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.