Proteintech, 23125-1-AP, SCT Polyclonal antibody

Size: 20ul / 150ul The SCT (23125-1-AP) by Proteintech is a Polyclonal antibody targeting SCT in IHC, ELISA applications with reactivity to human samples 23125-1-AP targets SCT in IF, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive IHC detected in: human liver cancer tissue, human stomach tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:20-1:200 Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag19419 Product name: Recombinant human SCT protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 25-121 aa of BC146571 Sequence: ARRHSDGTFTSELSRLREGARLQRLLQGLVGKRSEQDAENSMAWTRLSAGLLCPSGSNMPILQAWMPLDGTWSPWLPPGPMVSEPAGAAAEGTLRPR Predict reactive species Full Name: SCT Calculated Molecular Weight: 121 aa, 13 kDa GenBank Accession Number: BC146571 Gene Symbol: SCT Gene ID (NCBI): 6343 RRID: AB_2879214 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen Affinity purified UNIPROT ID: P09683 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.