Proteintech, 23253-1-AP, RSPH9 Polyclonal antibody

Size: 20ul / 150ul The RSPH9 (23253-1-AP) by Proteintech is a Polyclonal antibody targeting RSPH9 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 23253-1-AP targets RSPH9 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse testis tissue, NIH/3T3 cells, rat testis tissue Positive IHC detected in: rat brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information RSPH9 (Radial Spoke Head 9 Homolog) is a protein involved in the structure and function of cilia and flagella. Cilia and flagella are hair-like structures that extend from the surface of many eukaryotic cells and play critical roles in cell motility, sensory perception, and signaling. The RSPH9 protein is a component of the radial spoke, a structure within the axoneme (the core of cilia and flagella) that is essential for the regulation of ciliary and flagellar movement. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag19745 Product name: Recombinant human RSPH9 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-276 aa of BC029519 Sequence: MDADSLLLSLELASGSGQGLSPDRRASLLTSLMLVKRDYRYDRVLFWGRILGLVADYYIAQGLSEDQLAPRKTLYSLNCTEWSLLPPATEEMVAQSSVVKGRFMGDPSYEYEHTELQKVNEGEKVFEEEIVVQIKEETRLVSVIDQIDKAVAIIPRGALFKTPFGPTHVNRTFEGLSLSEAKKLSSYFHFREPVELKNKTLLEKADLDPSLDFMDSLEHDIPKGSWSIQMERGNALVVLRSLLWPGLTFYHAPRTKNYGYVYVGTGEKNMDLPFML Predict reactive species Full Name: radial spoke head 9 homolog (Chlamydomonas) Calculated Molecular Weight: 276 aa, 31 kDa Observed Molecular Weight: 31-35 kDa GenBank Accession Number: BC029519 Gene Symbol: RSPH9 Gene ID (NCBI): 221421 RRID: AB_2879240 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen Affinity purified UNIPROT ID: Q9H1X1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.