Proteintech, 23418-1-AP, Osteocalcin/OCN Polyclonal antibody

Size: 20ul / 150ul The Osteocalcin/OCN (23418-1-AP) by Proteintech is a Polyclonal antibody targeting Osteocalcin/OCN in IHC, IF/ICC, FC (Intra), ELISA applications with reactivity to human, mouse, rat samples 23418-1-AP targets Osteocalcin/OCN in IHC, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive IHC detected in: mouse testis tissue, human osteosarcoma tissue, human testis tissue, rat testis tissue, mouse kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: U2OS cells, NIH/3T3 cells Positive FC (Intra) detected in: NIH/3T3 cells, U2OS cells Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension Background Information Osteocalcin is a small, highly conserved molecule associated with mineralization of bone matrix. Osteocalcin is specifically expressed in osteoblasts and is the most abundant non-collagenous protein in bone. It regulates the dynamics of new bone formation and bone resorption by interaction with vitamin D, and by influencing the differentiation of osteoblasts. Osteocalcin is also involved in the posttranslational targeting of vitamin K-dependent gamma-carboxylation, which controls blood coagulation. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat, pig, canine, goat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag20065 Product name: Recombinant human Osteocalcin protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 24-100 aa of BC113432 Sequence: KPSGAESSKGAAFVSKQEGSEVVKRPRRYLYQWLGAPVPYPDPLEPRREVCELNPDCDELADHIGFQEAYRRFYGPV Predict reactive species Full Name: bone gamma-carboxyglutamate (gla) protein Calculated Molecular Weight: 100 aa, 11 kDa GenBank Accession Number: BC113432 Gene Symbol: Osteocalcin Gene ID (NCBI): 632 RRID: AB_2879275 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P02818 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.