Proteintech, 23826-1-AP, RSRC1 Polyclonal antibody

Size: 20ul / 150ul The RSRC1 (23826-1-AP) by Proteintech is a Polyclonal antibody targeting RSRC1 in WB, IHC, IF/ICC, ELISA applications with reactivity to human samples 23826-1-AP targets RSRC1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, HepG2 cells Positive IHC detected in: human small intestine tissue, human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information RSRC1, also named as SRRP53, is a novel SR-related protein of an apparent molecular mass of 53 kDa (45-53 kDa). It is isolated in a gene trap screen that identifies proteins which localize to the nuclear speckles. RSRC1 plays a rol in pre-mRNA splicing and constitutive. Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag20604 Product name: Recombinant human RSRC1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 172-334 aa of BC006982 Sequence: AGLEHLPPAEQAKARLQLVLEAAAKADEALKAKERNEEEAKRRKEEDQATLVEQVKRVKEIEAIESDSFVQQTFRSSKEVKKSVEPSEVKQATSTSGPASAVADPPSTEKEIDPTSIPTAIKYQDDNSLAHPNLFIEKADAEEKWFKRLIALRQERLMGSPVA Predict reactive species Full Name: arginine/serine-rich coiled-coil 1 Calculated Molecular Weight: 334 aa, 39 kDa Observed Molecular Weight: 38 kDa, 50 kDa GenBank Accession Number: BC006982 Gene Symbol: RSRC1 Gene ID (NCBI): 51319 RRID: AB_2879329 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen Affinity purified UNIPROT ID: Q96IZ7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.