Proteintech, 23909-1-AP, AFAP1L1 Polyclonal antibody

Size: 20ul / 150ul The AFAP1L1 (23909-1-AP) by Proteintech is a Polyclonal antibody targeting AFAP1L1 in WB, ELISA applications with reactivity to human, monkey samples 23909-1-AP targets AFAP1L1 in WB, ELISA applications and shows reactivity with human, monkey samples. Tested Applications Positive WB detected in: COS-7 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Background Information Actin Filament-Associated Protein of 110 kDa (AFAP-110/AFAP1) is an adaptor protein with multiple protein binding motifs that is known to function as both an actin binding protein and a cSrc activating protein. A homology search of AFAP1 recently identified AFAP1L1 which has a similar sequence, domain structure and cellular localization. AFAP1L1 is highly expressed in human breast, colon and brain tissue. AFAP1L1 interacts with cortactin and involves the invadosomes formation. AFAP1L1 as a prognostic marker has a role in the progression of spindle cell sarcomas. Specification Tested Reactivity: human, monkey Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag21006 Product name: Recombinant human AFAP1L1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-117 aa of BC125093 Sequence: MDRGQVLEQLLPELTGLLSLLDHEYLSDTTLEKKMAVASILQSLQPLPAKEVSYLYVNTADLHSGPSFVESLFEEFDCDLSDLRDMPEDDGEPSKGASPELAKSPRLRNAADLPPPL Predict reactive species Full Name: actin filament associated protein 1-like 1 Calculated Molecular Weight: 768 aa, 86 kDa Observed Molecular Weight: 75-86 kDa GenBank Accession Number: BC125093 Gene Symbol: AFAP1L1 Gene ID (NCBI): 134265 RRID: AB_2879358 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen Affinity purified UNIPROT ID: Q8TED9 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.