Proteintech, 23988-1-AP, TTLL2 Polyclonal antibody

Size: 20ul / 150ul The TTLL2 (23988-1-AP) by Proteintech is a Polyclonal antibody targeting TTLL2 in WB, ELISA applications with reactivity to human, mouse, rat samples 23988-1-AP targets TTLL2 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, rat brain tissue, human placenta tissue Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information TTLL2 belongs to the Tubulin Tyrosine Ligase-Like (TTLL) family, binds to tubulin and catalyzes the polyglutamylation modification of tubulin, participating in the organization and dynamic regulation of the microtubule cytoskeleton. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag21143 Product name: Recombinant human TTLL2 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 83-431 aa of BC047411 Sequence: LLKPLVFRVDETTPAVVQSVLLERGWNKFDKQEQNAEDWNLYWRTSSFRMTEHNSVKPWQQLNHHPGTTKLTRKDCLAKHLKHMRRMYGTSLYQFIPLTFVMPNDYTKFVAEYFQERQMLGTKHSYWICKPAELSRGRGILIFSDFKDFIFDDMYIVQKYISNPLLIGRYKCDLRIYVCVTGFKPLTIYVYQEGLVRFATEKFDLSNLQNNYAHLTNSSINKSGASYEKIKEVIGHGCKWTLSRFFSYLRSWDVDDLLLWKKIHRMVILTILAIAPSVPFAANCFELFGFDILIDDNLKPWLLEVNYSPALTLDCSTDVLVKRKLVHDIIDLIYLNGLRNEGGEASNAT Predict reactive species Full Name: tubulin tyrosine ligase-like family, member 2 Calculated Molecular Weight: 592 aa, 67 kDa Observed Molecular Weight: 67 kDa GenBank Accession Number: BC047411 Gene Symbol: TTLL2 Gene ID (NCBI): 83887 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen Affinity purified UNIPROT ID: Q9BWV7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.