Proteintech, 23992-1-AP, TMEM55B Polyclonal antibody

Size: 20ul / 150ul The TMEM55B (23992-1-AP) by Proteintech is a Polyclonal antibody targeting TMEM55B in WB, IP, ELISA applications with reactivity to human, mouse, rat samples 23992-1-AP targets TMEM55B in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, mouse heart tissue, A549 cells, HepG2 cells, MCF-7 cells, rat heart tissue Positive IP detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Background Information TMEM55B is also named as C14orf9 and PIP4P1. TMEM55B is originally identified as phosphatidylinositol-4,5-P24-phosphatases (PtdIns-4,5-P24-phosphatases) that catalyze dephosphorylation of PtdIns-4,5-P2 to PtdIns-5-P. The transmembrane protein TMEM55B is involved in the perinuclear clustering of lysosomes upon starvation. TMEM55B expression is upregulated upon starvation via TFEB and TFE3 activation, and loss of TMEM55B diminishes starvation-induced lysosomal clustering. TMEM55B can bind to the dynein adaptor JIP4, promoting dynein-dynactin-dependent lysosomal trafficking to the perinuclear region. TMEM55B is also suggested to contribute to lysosomal homeostasis and mTORC1 activation via the V-ATPase assembly (PMID: 33537719). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat, monkey Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag21172 Product name: Recombinant human TMEM55B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 15-83 aa of BC002867 Sequence: IDGGAGGNGLVGPGGSGAGPGGGLTPSAPPYGAAFPPFPEGHPAVLPGEDPPPYSPLTSPDSGSAPMIT Predict reactive species Full Name: transmembrane protein 55B Calculated Molecular Weight: 277 aa, 29 kDa Observed Molecular Weight: 29-32 kDa GenBank Accession Number: BC002867 Gene Symbol: TMEM55B Gene ID (NCBI): 90809 RRID: AB_2879391 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q86T03 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.