Proteintech, 24031-1-AP, ASB5 Polyclonal antibody

Size: 20ul / 150ul The ASB5 (24031-1-AP) by Proteintech is a Polyclonal antibody targeting ASB5 in WB, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 24031-1-AP targets ASB5 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse skeletal muscle tissue, mouse heart tissue, rat skeletal muscle tissue Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information ASB5, also named as Ankyrin repeat and SOCS box-containing 5, is a 329 amino acid protein, which contains a conserved one C-terminal SOCS box motif. Asb5 was significantly upregulated in growing collateral arteries on mRNA and protein level. It has been shown that asb5 is a protein implicated in the initiation of arteriogenesis. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag21230 Product name: Recombinant human ASB5 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 245-329 aa of BC065710 Sequence: STEIVNLLLEFGADINAKNTELLRPIDVATSSSMVERILLQHEATPSSLYQLCRLCIRSYIGKPRLHLIPQLQLPTLLKNFLQYR Predict reactive species Full Name: ankyrin repeat and SOCS box-containing 5 Calculated Molecular Weight: 329 aa, 36 kDa Observed Molecular Weight: 36-40 kDa GenBank Accession Number: BC065710 Gene Symbol: ASB5 Gene ID (NCBI): 140458 RRID: AB_2879410 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8WWX0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.