Proteintech, 24050-1-AP, Glucocorticoid receptor Polyclonal antibody

Size: 20ul / 150ul The Glucocorticoid receptor (24050-1-AP) by Proteintech is a Polyclonal antibody targeting Glucocorticoid receptor in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples 24050-1-AP targets Glucocorticoid receptor in WB, IHC, IF/ICC, IP, CoIP, ChIP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HEK-293 cells, HeLa cells, HepG2 cells, DU 145 cells, mouse brain tissue, rat brain tissue, PC-12 cells Positive IP detected in: HepG2 cells, mouse heart tissue Positive IHC detected in: human prostate cancer tissue, human ovary tumor tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells, A549 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information Glucocorticoid receptor (GR, or GCR) also known as NR3C1 (nuclear receptor subfamily 3, group C, member 1) is a receptor for glucocorticoids, which owns a dual mode of action: as a transcription factor that binds to glucocorticoid response elements (GRE) and as a modulator of other transcription factors. It is involved in cell proliferation and differentiation and specifically implicated in newborn birth weight, thus providing a biological mechanism by which NR3C1 expression may influence birth weight (PMID:22810058). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat, chicken, zebrafish, rare minnow Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag21146 Product name: Recombinant human Glucocorticoid receptor protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-350 aa of BC015610 Sequence: MDSKESLTPGREENPSSVLAQERGDVMDFYKTLRGGATVKVSASSPSLAVASQSDSKQRRLLVDFPKGSVSNAQQPDLSKAVSLSMGLYMGETETKVMGNDLGFPQQGQISLSSGETDLKLLEESIANLNRSTSVPENPKSSASTAVSAAPTEKEFPKTHSDVSSEQQHLKGQTGTNGGNVKLYTTDQSTFDILQDLEFSSGSPGKETNESPWRSDLLIDENCLLSPLAGEDDSFLLEGNSNEDCKPLILPDTKPKIKDNGDLVLSSPSNVTLPQVKTEKEDFIELCTPGVIKQEKLGTVYCQASFPGANIIGNKMSAISVHGVSTSGGQMYHYDMNTASLSQQQDQKPI Predict reactive species Full Name: nuclear receptor subfamily 3, group C, member 1 (glucocorticoid receptor) Calculated Molecular Weight: 86 kDa Observed Molecular Weight: 94-97 kDa GenBank Accession Number: BC015610 Gene Symbol: Glucocorticoid receptor Gene ID (NCBI): 2908 RRID: AB_2813890 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P04150 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.