Proteintech, 24055-1-AP, HSN2 Polyclonal antibody

Size: 20ul / 150ul The HSN2 (24055-1-AP) by Proteintech is a Polyclonal antibody targeting HSN2 in WB, IHC, ELISA applications with reactivity to human, mouse samples 24055-1-AP targets HSN2 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse brain tissue, MCF-7 cells Positive IHC detected in: human kidney tissue, human gliomas tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Background Information HSN2, also named as WNK1, KDP, KIAA0344, PRKWNK1, P65 and hWNK1, is a serine/threonine kinase which plays an important role in the regulation of electrolyte homeostasis, cell signaling, survival, and proliferation. It acts as an activator and inhibitor of sodium-coupled chloride cotransporters and potassium-coupled chloride cotransporters respectively. WNK1 may also play a role in actin cytoskeletal reorganization. This antibody detects the 65 kDa protein (Erythrocyte 65 kDa protein, P65). Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag21184 Product name: Recombinant human HSN2 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 86-434 aa of BC130469 Sequence: PGGSPTNWTPEAVVMLGTTASRVTGESCEIQVHPMFEPSQVYSDYRPGLVLPEEAHYFIPQEAVYVAGVHYQARVAEQYEGIPYNSSVLSSPMKQIPEQKPVQGGPTSSSVFEFPSGQAFLVGHLQNLRLDSGLGPGSPLSSISAPISTDATRLKFHPVFVPHSAPAVLTHNNESRSNCVFEFHVHTPSSSSGEGGGILPQRVYRNRQVAVDLNQEELPPQSVGLHGYLQPVTEEKHNYHAPELTVSVVEPIGQNWPIGSPEYSSDSSQITSSDPSDFQSPPPTGGAAAPFGSDVSMPFIHLPQTVLQESPLFFCFPQGTTSQQVLTASFSSGGSALHPQVIGKLPQLF Predict reactive species Full Name: hereditary sensory neuropathy, type II Calculated Molecular Weight: 2634 aa, 280 kDa Observed Molecular Weight: 65 kDa GenBank Accession Number: BC130469 Gene Symbol: HSN2 Gene ID (NCBI): 378465 RRID: AB_2879417 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen Affinity purified UNIPROT ID: Q9H4A3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.