Proteintech, 24168-1-AP, XBP1S/XBP1U Polyclonal antibody

Size: 20ul / 150ul The XBP1S/XBP1U (24168-1-AP) by Proteintech is a Polyclonal antibody targeting XBP1S/XBP1U in WB, IHC, FC (Intra), ELISA applications with reactivity to human, mouse samples 24168-1-AP targets XBP1S/XBP1U in WB, IHC, FC (Intra), ChIP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HepG2 cells, HEK-293 cells, Jurkat cells, Raji cells Positive IHC detected in: human breast cancer tissue, mouse liver tissue, human colon cancer tissue, human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive FC (Intra) detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:5000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension Background Information XBP1 is also named as XBP2, belongs to the bZIP family. The X-box-binding protein-1 (XBP1) is a transcriptional regulator of the ER stress response that lies downstream of inositol-requiring enzyme 1 (IRE1α) activation (PMID: 14559994). IRE1α possesses both kinase and ribonuclease activity and processes XBP1 mRNA to produce an active transcription factor in response to ER stress (PMID: 11779464, 11780124). It has been found that upon accumulation of unfolded proteins in the endoplasmic reticulum, the mRNA of this gene is processed to an active form by an unconventional splicing mechanism that is mediated by the endonuclease inositol-requiring enzyme 1. The resulting loss of 26 nt from the spliced mRNA causes a frame-shift and an isoform XBP1S, which is the functionally active transcription factor. The isoform encoded by the unspliced mRNA, XBP1U, is constitutively expressed, and thought to function as a negative feedback regulator of XBP1S, which shuts off transcription of target genes during the recovery phase of ER stress (PMID: 11850408). The unspliced XBP1U isoform is composed of 261 amino acid residues, and the spliced XBP1S isoform is composed of 376 amino acid residues. The XBP1 antibody (24168-1-AP) can detect both XBP1U and XBP1S. Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag21454 Product name: Recombinant human XBP1 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 1-167 aa of BC000938 Sequence: MVVVAAAPNPADGTPKVLLLSGQPASAAGAPAGQALPLMVPAQRGASPEAASGGLPQARKRQRLTHLSPEEKALRRKLKNRVAAQTARDRKKARMSELEQQVVDLEEENQKLLLENQLLREKTHGLVVENQELRQRLGMDALVAEEEAEAKGNEVRPVAGSAESAAL Predict reactive species Full Name: X-box binding protein 1 Calculated Molecular Weight: 261 aa, 29 kDa Observed Molecular Weight: ~32 kDa; ~60 kDa GenBank Accession Number: BC000938 Gene Symbol: XBP1 Gene ID (NCBI): 7494 RRID: AB_2879445 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen Affinity purified UNIPROT ID: P17861 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.