Iright
BRAND / VENDOR: Proteintech

Proteintech, 24200-1-AP, ROMO1 Polyclonal antibody

CATALOG NUMBER: 24200-1-AP
السعر العادي$0.99
/
  • ddddd

    99 xxxxxx

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The ROMO1 (24200-1-AP) by Proteintech is a Polyclonal antibody targeting ROMO1 in WB, IHC, ELISA applications with reactivity to human samples 24200-1-AP targets ROMO1 in WB, IHC, IF, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HEK-293 cells Positive IHC detected in: human lung cancer tissue, human gliomas tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Specification Tested Reactivity: human Cited Reactivity: human, rat, pig Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag20368 Product name: Recombinant human ROMO1 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 1-79 aa of BC008488 Sequence: MPVAVGPYGQSQPSCFDRVKMGFVMGCAVGMAAGALFGTFSCLRIGMRGRELMGGIGKTMMQSGGTFGTFMAIGMGIRC Predict reactive species Full Name: reactive oxygen species modulator 1 Calculated Molecular Weight: 79 aa, 8 kDa Observed Molecular Weight: 6-10 kDa GenBank Accession Number: BC008488 Gene Symbol: ROMO1 Gene ID (NCBI): 140823 RRID: AB_2879453 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P60602 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924