Proteintech, 24226-1-AP, TMEM63B Polyclonal antibody

Size: 20ul / 150ul The TMEM63B (24226-1-AP) by Proteintech is a Polyclonal antibody targeting TMEM63B in WB, ELISA applications with reactivity to human, mouse samples 24226-1-AP targets TMEM63B in WB, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse kidney tissue Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Background Information TMEM63B, also known as C6orf110, belongs to the TMEM63 family. TMEM63B is a mechanosensitive cation channel activated by hypoosmotic stress and mechanic stimulation. Genetic deletion of TMEM63B is a cause of necroptosis of outer hair cells (OHCs) and progressive hearing loss (PMID: 32375046). Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag21573 Product name: Recombinant human TMEM63B protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 700-832 aa of BC136769 Sequence: TMRTGFLAPTSMFTFVVLVITIVICLCHVCFGHFKYLSAHNYKIEHTETDTVDPRSNGRPPTAAAVPKSAKYIAQVLQDSEVDGDGDGAPGSSGDEPPSSSSQDEELLMPPDALTDTDFQSCEDSLIENEIHQ Predict reactive species Full Name: transmembrane protein 63B Calculated Molecular Weight: 832 aa, 95 kDa Observed Molecular Weight: 95 kDa GenBank Accession Number: BC136769 Gene Symbol: TMEM63B Gene ID (NCBI): 55362 RRID: AB_3085727 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen Affinity purified UNIPROT ID: Q5T3F8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.