Proteintech, 24272-1-AP, Frizzled 2 Polyclonal antibody

Size: 20ul / 150ul The Frizzled 2 (24272-1-AP) by Proteintech is a Polyclonal antibody targeting Frizzled 2 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 24272-1-AP targets Frizzled 2 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: Caco-2 cells, mouse colon tissue, rat kidney tissue, HEK-293 cells, mouse colon tisue Positive IHC detected in: mouse colon tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information Frizzled 2(FZD2) also known as FzE2, which belongs to the G-protein coupled receptor Fz/Smo family. FZD2 is an important receptor in the Wnt pathway, which is highly expressed in malignant tumors and helps regulate multiple tumor behaviors. Its expression level is related to prognosis. Moreover, high level of FZD2 had significant correlation with poor prognosis in Breast cancer (BC) patients(PMID: 33832493). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag18003 Product name: Recombinant human FZD2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 138-217 aa of BC113402 Sequence: CEHFPRHGAEQICVGQNHSEDGAPALLTTAPPPGLQPGAGGTPGGPGGGGAPPRYATLEHPFHCPRVLKVPSYLSYKFLG Predict reactive species Full Name: frizzled homolog 2 (Drosophila) Calculated Molecular Weight: 565 aa, 64 kDa Observed Molecular Weight: 64-70 kDa GenBank Accession Number: BC113402 Gene Symbol: Frizzled 2 Gene ID (NCBI): 2535 RRID: AB_2879463 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q14332 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.