Proteintech, 24300-1-AP, LIPI Polyclonal antibody

Size: 20ul / 150ul The LIPI (24300-1-AP) by Proteintech is a Polyclonal antibody targeting LIPI in WB, IHC, ELISA applications with reactivity to human, mouse samples 24300-1-AP targets LIPI in WB, IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: A549 cells, mouse lung tissue Positive IHC detected in: human testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag19024 Product name: Recombinant human LIPI protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 264-481 aa of BC148691 Sequence: FSGIQFIKCNHQRAVHLFMASLETNCNFISFPCRSYKDYKTSLCVDCDCFKEKSCPRLGYQAKLFKGVLKERMEGRPLRTTVFLDTSGTYPFCTYYFVLSIIVPDKTMMDGSFSFKLLNQLGMIEEPRLYEKNKPFYKLQEVKILAQFYNDFVNISSIGLTYFQSSNLQCSTCTYKIQRLMLKSLTYPERPPLCRYNIVLKDREEVFLNPNTCTPKNT Predict reactive species Full Name: lipase, member I Calculated Molecular Weight: 460 aa, 55 kDa Observed Molecular Weight: 50 kDa GenBank Accession Number: BC148691 Gene Symbol: LIPI Gene ID (NCBI): 149998 RRID: AB_2879483 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q6XZB0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.