Proteintech, 24320-1-AP, DGKB Polyclonal antibody

Size: 20ul / 150ul The DGKB (24320-1-AP) by Proteintech is a Polyclonal antibody targeting DGKB in WB, IHC, ELISA applications with reactivity to human samples 24320-1-AP targets DGKB in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells Positive IHC detected in: human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:100-1:400 Background Information DGKB(Diacylglycerol kinase beta) is also named as DAGK2, KIAA0718 , 90 kDa diacylglycerol kinase and belongs to the eukaryotic diacetylglycerol kinase family. It is a key enzyme in lipid metabolism that functions to reintroduce diacylglycerol formed from the hydrolysis of phospholipids into the biosynthetic pathway. This protein has 2 isoforms produced by alternative splicing with the molecular weight of 87 kDa and 91 kDa. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag19809 Product name: Recombinant human DGKB protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 30-140 aa of BC105005 Sequence: KDVLEEFHGNGVLAKYNPEGKQDILNQTIDFEGFKLFMKTFLEAELPDDFTAHLFMSFSNKFPHSSPMVKSKPALLSGGLRMNKGAITPPRTTSPANTCSPEVIHLKDIVC Predict reactive species Full Name: diacylglycerol kinase, beta 90kDa Calculated Molecular Weight: 804 aa, 91 kDa Observed Molecular Weight: 91 kDa GenBank Accession Number: BC105005 Gene Symbol: DGKB Gene ID (NCBI): 1607 RRID: AB_2879492 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9Y6T7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.