Product Description
Size: 20ul / 150ul
The DGKB (24320-1-AP) by Proteintech is a Polyclonal antibody targeting DGKB in WB, IHC, ELISA applications with reactivity to human samples
24320-1-AP targets DGKB in WB, IHC, ELISA applications and shows reactivity with human samples.
Tested Applications
Positive WB detected in: HeLa cells
Positive IHC detected in: human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0
Recommended dilution
Western Blot (WB): WB : 1:500-1:2000
Immunohistochemistry (IHC): IHC : 1:100-1:400
Background Information
DGKB(Diacylglycerol kinase beta) is also named as DAGK2, KIAA0718 , 90 kDa diacylglycerol kinase and belongs to the eukaryotic diacetylglycerol kinase family. It is a key enzyme in lipid metabolism that functions to reintroduce diacylglycerol formed from the hydrolysis of phospholipids into the biosynthetic pathway. This protein has 2 isoforms produced by alternative splicing with the molecular weight of 87 kDa and 91 kDa.
Specification
Tested Reactivity: human
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag19809 Product name: Recombinant human DGKB protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 30-140 aa of BC105005 Sequence: KDVLEEFHGNGVLAKYNPEGKQDILNQTIDFEGFKLFMKTFLEAELPDDFTAHLFMSFSNKFPHSSPMVKSKPALLSGGLRMNKGAITPPRTTSPANTCSPEVIHLKDIVC Predict reactive species
Full Name: diacylglycerol kinase, beta 90kDa
Calculated Molecular Weight: 804 aa, 91 kDa
Observed Molecular Weight: 91 kDa
GenBank Accession Number: BC105005
Gene Symbol: DGKB
Gene ID (NCBI): 1607
RRID: AB_2879492
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: Q9Y6T7
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924