Proteintech, 24361-1-AP, TMEM25 Polyclonal antibody

Size: 20ul / 150ul The TMEM25 (24361-1-AP) by Proteintech is a Polyclonal antibody targeting TMEM25 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 24361-1-AP targets TMEM25 in WB, IF, IHC, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse liver tissue, rat liver tissue Positive IHC detected in: human liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:250-1:1000 Background Information TMEM25 is a novel member of the immunoglobulin superfamily. BC042896 and AY358919 cDNAs are derived from human TMEM25 gene. TMEM25 isoform 1 (BC042896), consisting of exons 1-9, encodes a 366-aa transmembrane protein. TMEM25 isoform 2 (AY358919), consisting of exons 1-4 and 6-9, encodes a 322-aa secreted protein (PMID:15254712). Human TMEM25 gene are found to encode transmembrane-type as well as secreted-type proteins due to alternative splicing of exon-skipping type. TMEM25 mRNA is expressed in brain, including cerebellar cortex and hippocampus, as well as in neuroblastoma, brain tumors, and gastric cancer. TMEM25 is a target of pharmacogenomics in the field of oncology and regenerative medicine. TMEM25 mRNAs may be useful members of a panel of favorable prognostic and predictive markers for breast cancer( PMID:19776672). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag19964 Product name: Recombinant human TMEM25 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 28-323 aa of BC051841 Sequence: LEPQIDGQTWAERALRENERHAFTCRVAGGPGTPRLAWYLDGQLQEASTSRLLSVGGEAFSGGTSTFTVTAHRAQHELNCSLQDPRSGRSANASVILNVQFKPEIAQVGAKYQEAQGPGLLVVLFALVRANPPANVTWIDQDGPVTVNTSDFLVLDAQNYPWLTNHTVQLQLRSLAHNLSVVATNDVGVTSASLPAPGPSRHPSLISSDSNNLKLNNVRLPRENMSLPSNLQLNDLTPDSRAVKPADRQMAQNNSRPELLDPEPGGLLTSRGFIRLPVLGYIYRVSSVSSDEIWL Predict reactive species Full Name: transmembrane protein 25 Calculated Molecular Weight: 366 aa, 39 kDa Observed Molecular Weight: 40 kDa GenBank Accession Number: BC051841 Gene Symbol: TMEM25 Gene ID (NCBI): 84866 RRID: AB_2879507 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q86YD3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.