Iright
BRAND / VENDOR: Proteintech

Proteintech, 24366-1-AP, GPATCH2 Polyclonal antibody

CATALOG NUMBER: 24366-1-AP
السعر العادي$0.99
/
  • ddddd

    99 xxxxxx

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The GPATCH2 (24366-1-AP) by Proteintech is a Polyclonal antibody targeting GPATCH2 in WB, IHC, ELISA applications with reactivity to human, mouse samples 24366-1-AP targets GPATCH2 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse spleen tissue, mouse kidney tissue, mouse thymus tissue Positive IHC detected in: human breast cancer tissue, human testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Specification Tested Reactivity: human, mouse Cited Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag21647 Product name: Recombinant human GPATCH2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 290-376 aa of BC063474 Sequence: KESGGACGITGVVPWWEKEDPTELDKNVPDPVFESILTGSFPLMSHPSRRGFQARLSRLHGMSSKNIKKSGGTPTSMATNWTSEIPL Predict reactive species Full Name: G patch domain containing 2 Calculated Molecular Weight: 528 aa, 59 kDa Observed Molecular Weight: 65-70 kDa GenBank Accession Number: BC063474 Gene Symbol: GPATCH2 Gene ID (NCBI): 55105 RRID: AB_2879508 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9NW75 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924