Proteintech, 24428-1-AP, CEP135 Polyclonal antibody

Size: 20ul / 150ul The CEP135 (24428-1-AP) by Proteintech is a Polyclonal antibody targeting CEP135 in WB, IF/ICC, ELISA applications with reactivity to human, Canine samples 24428-1-AP targets CEP135 in WB, IF/ICC, ELISA applications and shows reactivity with human, Canine samples. Tested Applications Positive WB detected in: HeLa cells, K-562 cells, U2OS cells, U-87 MG cells Positive IF/ICC detected in: MDCK cells Recommended dilution Western Blot (WB): WB : 1:1000-1:3000 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information CEP135 is a 135 kDa centrosomal protein that is present in a wide range of organisms. CEP135 is located at the centrosome throughout the cell cycle, and localization is independent of the microtubule network. It distributes throughout the centrosomal area in association with the electron-dense material surrounding centrioles. Specification Tested Reactivity: human, Canine Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag19122 Product name: Recombinant human CEP135 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-233 aa of BC136535 Sequence: MTTAVERKYINIRKRLDQLGYRQTLTVECLPLVEKLFSDLVHTTESLRQSKLSAVKAEKESANFDFVLEPYKLENARLSRENNELYLELMKLREHSDQHVKELKTSLKKCARETADLKFLNNQYAHKLKLLEKESKAKNERIQQLQEKNLHAVVQTPGGKKRSIAFRRQRMQIDEPVPPSEVSSYPVPQPDDPYIADLLQVADNRIQELQQEVHQLQEKLAMMESGVRDYSKQ Predict reactive species Full Name: centrosomal protein 135kDa Calculated Molecular Weight: 1140 aa, 134 kDa Observed Molecular Weight: 135 kDa GenBank Accession Number: BC136535 Gene Symbol: CEP135 Gene ID (NCBI): 9662 RRID: AB_2879543 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q66GS9 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.