Proteintech, 24546-1-AP, PTPN6/SHP1 Polyclonal antibody

Size: 20ul / 150ul The PTPN6/SHP1 (24546-1-AP) by Proteintech is a Polyclonal antibody targeting PTPN6/SHP1 in WB, IHC, IF/ICC, FC (Intra), IP, ELISA applications with reactivity to human, mouse, rat samples 24546-1-AP targets PTPN6/SHP1 in WB, IHC, IF/ICC, FC (Intra), IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: Raji cells, Jurkat cells, HuH-7 cells Positive IP detected in: Jurkat cells Positive IHC detected in: human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: MCF-7 cells Positive FC (Intra) detected in: MCF-7 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.20 ug per 10^6 cells in a 100 µl suspension Background Information PTPN6(Tyrosine-protein phosphatase non-receptor type 6) is also named as HCP, PTP1C and belongs to the protein-tyrosine phosphatase family. It regulates muscle INS action in a cell-autonomous manner, further suggesting that the PTPase negatively modulates INS action through down-regulation of both INS signaling to AKT1 and SLC2A4 translocation, as well as SLC2A4 expression(PMID:21952243). It has 4 isoforms produced by alternative splicing. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag21415 Product name: Recombinant human PTPN6 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 506-598 aa of BC002523 Sequence: QYKFIYVAIAQFIETTKKKLEVLQSQKGQESEYGNITYPPAMKNAHAKASRTSSKHKEDVYENLHTKNKREEKVKKQRSADKEKSKGSLKRK Predict reactive species Full Name: protein tyrosine phosphatase, non-receptor type 6 Calculated Molecular Weight: 597 aa, 68 kDa Observed Molecular Weight: 63 kDa GenBank Accession Number: BC002523 Gene Symbol: PTPN6/SHP1 Gene ID (NCBI): 5777 RRID: AB_2879600 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P29350 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.