Proteintech, 24599-1-AP, RAB3GAP2 Polyclonal antibody

Size: 20ul / 150ul The RAB3GAP2 (24599-1-AP) by Proteintech is a Polyclonal antibody targeting RAB3GAP2 in WB, ELISA applications with reactivity to human, mouse samples 24599-1-AP targets RAB3GAP2 in WB, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HEK-293 cells, HeLa cells, Jurkat cells, mouse brain tissue Recommended dilution Western Blot (WB): WB : 1:2000-1:8000 Background Information RAB3GAP2, also known as RAB3-GAP150, belongs to the Rab3-GAP regulatory subunit family. Rab3 GAP consists of two subunits: the catalytic subunit p130 and the noncatalytic subunit p150. Rab3 GAP is ubiquitously expressed and enriched in the synaptic soluble fraction of brain, consistent with it having a key role in neurodevelopment. RAB3-GAP150 forms the Rab3 GTPase-activating complex with RAB3-GAP130,where it constitutes the regulatory subunit, whereas the latter functions as the catalytic subunit. Defects in RAB3-GAP150 are the cause of Martsolf and Warburg Micro syndrome. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag20254 Product name: Recombinant human RAB3GAP2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-204 aa of BC146760 Sequence: MACSIVQFCYFQDLQAARDFLFPHLREEILSGALRRDPSKSTDWEDDGWGAWEENEPQEPEEEGNTCKTQKTSWLQDCVLSLSPTNDLMVIAREQKAVFLVPKWKYSDKGKEEMQFAVGWSGSLNVEEGECVTSALCIPLASQKRSSTGRPDWTCIVVGFTSGYVRFYTENGVLLLAQLLNEDPVLQLKCRTYEIPRHPGVTEQ Predict reactive species Full Name: RAB3 GTPase activating protein subunit 2 (non-catalytic) Calculated Molecular Weight: 1393 aa, 156 kDa Observed Molecular Weight: 150 kDa GenBank Accession Number: BC146760 Gene Symbol: RAB3GAP2 Gene ID (NCBI): 25782 RRID: AB_2879632 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9H2M9 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.