Proteintech, 24656-1-AP, SPINK5L3 Polyclonal antibody

Size: 20ul / 150ul The SPINK5L3 (24656-1-AP) by Proteintech is a Polyclonal antibody targeting SPINK5L3 in IHC, ELISA applications with reactivity to human, mouse, rat samples 24656-1-AP targets SPINK5L3 in IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive IHC detected in: rat testis tissue, mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information SPINK5L3 (Serine protease inhibitor Kazal-type 13) may be a serine protease inhibitor. It enables serine-type endopeptidase inhibitor activity, which is involved in the negative regulation of the acrosome reaction. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag19715 Product name: Recombinant human SPINK5L3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 40-94 aa of BC128164 Sequence: KMYIPLDPDYNADCPNVTAPVCASNGHTFQNECFFCVEQREFHYRIKFEKYGKCD Predict reactive species Full Name: serine PI Kazal type 5-like 3 Calculated Molecular Weight: 94 aa, 11 kDa GenBank Accession Number: BC128164 Gene Symbol: SPINK5L3 Gene ID (NCBI): 153218 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q1W4C9 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.