Iright
BRAND / VENDOR: Proteintech

Proteintech, 24676-1-AP, ATP13A5 Polyclonal antibody

CATALOG NUMBER: 24676-1-AP
السعر العادي$0.99
/
  • ddddd

    99 xxxxxx

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The ATP13A5 (24676-1-AP) by Proteintech is a Polyclonal antibody targeting ATP13A5 in IHC, IF-P, ELISA applications with reactivity to human, mouse, rat samples 24676-1-AP targets ATP13A5 in IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive IHC detected in: mouse kidney tissue, mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: rat brain tissue Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Background Information ATP13A5 is a member of the P5 subfamily of P-type transport ATPases. ATP13A5 functions within the intracellular membrane system and is mainly responsible for maintaining the ionic homeostasis and phospholipid balance of the intracellular membrane system. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag20337 Product name: Recombinant human ATP13A5 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1123-1218 aa of BC156652 Sequence: TQFCVAFFVEDSILQNHELWLLIKREFGFYSKSQYRTWQKKLAEDSTWPPINRTDYSGDGKNGFYINGGYESHEQIPKRKLKLGGQPTEQHFWARL Predict reactive species Full Name: ATPase type 13A5 Calculated Molecular Weight: 1218 aa, 137 kDa GenBank Accession Number: BC156652 Gene Symbol: ATP13A5 Gene ID (NCBI): 344905 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q4VNC0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924