Proteintech, 24717-1-AP, YEATS2 Polyclonal antibody

Size: 20ul / 150ul The YEATS2 (24717-1-AP) by Proteintech is a Polyclonal antibody targeting YEATS2 in WB, IP, ELISA applications with reactivity to human samples 24717-1-AP targets YEATS2 in WB, IHC, IP, CoIP, ChIP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: Jurkat cells Positive IP detected in: Jurkat cells Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Background Information YEATS domain containing 2 (YEATS2) protein is a scaffolding subunit of the ATAC complex. Studies have shown that YEATS2 is a selective histone crotonylation reader and is related to histone acetylation. In addition, YEATS2 is associated with the progression of various tumors. Overexpression of YEATS2 promotes the proliferation and migration of pancreatic cancer cells. YEATS2 has been reported to be associated with the progression of non-small-cell lung cancer through histone acetylation. Specification Tested Reactivity: human Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag20134 Product name: Recombinant human YEATS2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1066-1422 aa of BC150273 Sequence: VQTILMPVNKVVQSFSTSKPPAILPVAAPTPVVPSSAPAAVAKVKTEPETPGPSCLSQEGQTAVKTEESSELGNYVIKIDHLETIQQLLTAVVKKIPLITAKSEDASCFSAKSVEQYYGWNIGKRRAAEWQRAMTMRKVLQEILEKNPRFHHLTPLKTKHIAHWCRCHGYTPPDPESLRNDGDSIEDVLTQIDSEPECPSSFSSADNLCRKLEDLQQFQKREPENEEEVDILSLSEPVKINIKKEQEEKQEEVKFYLPPTPGSEFIGDVTQKIGITLQPVALHRNVYASVVEDMILKATEQLVNDILRQALAVGYQTASHNRIPKEITVSNIHQAICNIPFLDFLTNKHMGILNEDQ Predict reactive species Full Name: YEATS domain containing 2 Calculated Molecular Weight: 1422 aa, 151 kDa Observed Molecular Weight: 151 kDa GenBank Accession Number: BC150273 Gene Symbol: YEATS2 Gene ID (NCBI): 55689 RRID: AB_2879686 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9ULM3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.