Iright
BRAND / VENDOR: Proteintech

Proteintech, 24793-1-AP, INO80C Polyclonal antibody

CATALOG NUMBER: 24793-1-AP
السعر العادي$0.99
/
  • ddddd

    99 xxxxxx

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The INO80C (24793-1-AP) by Proteintech is a Polyclonal antibody targeting INO80C in IHC, ELISA applications with reactivity to human samples 24793-1-AP targets INO80C in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive IHC detected in: human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:20-1:200 Specification Tested Reactivity: human Cited Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag20468 Product name: Recombinant human INO80C protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-96 aa of BC048989 Sequence: MEAMSENKMVPSEFSTGPVEKAAKPLPFKDPNFVHSGHGGAVAGKKNRTWKNLKQILASERALPWQLNDPNYFSIDAPPSFKPAKKYSDVSGLLAN Predict reactive species Full Name: INO80 complex subunit C Calculated Molecular Weight: 192 aa, 21 kDa GenBank Accession Number: BC048989 Gene Symbol: INO80C Gene ID (NCBI): 125476 RRID: AB_2879729 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q6PI98 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924