Proteintech, 24817-1-AP, USP50 Polyclonal antibody

Size: 20ul / 150ul The USP50 (24817-1-AP) by Proteintech is a Polyclonal antibody targeting USP50 in WB, IHC, ELISA applications with reactivity to human, mouse samples 24817-1-AP targets USP50 in WB, IF, IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse testis tissue Positive IHC detected in: human hepatocirrhosis tissue, mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information Ubiquitin-specific protease 50 (USP50) belongs to the peptidase C19 family. USP50 has been shown to regulate cell cycle and DNA repair through interaction with the Wee1 protein in transformed human osteosarcoma and human epithelial cell lines. USP50 has also been shown to play a role in inflammasomal function by targeting the adaptor protein (PMID: 29101126). USP50 has 2 isoforms with the molecular mass of 38 and 39 kDa. Sometimes higher molecular weight around 44 kDa can also be observed, which may be a modified variant of USP50. Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag19337 Product name: Recombinant human USP50 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-339 aa of BC146493 Sequence: MTSQPSLPADDFDIYHVLAECTDYYDTLPVKEADGNQPHFQGVTGLWNLGNTCCVNAISQCLCSILPLVEYFLTGKYITALQKFLLPSDCSEVATAFAYLMTDMWLGDSDCVSPEIFWSALGNLYPAFTKKMQQDAQEFLICVLNELHEALKKYHYSRRRSYEKGSTQRCCRKWITTETSIITQLFEEQLNYSIVCLKCEKCTYKNEVFTVFSLPIPSKYECSLRDCLQCFFQQDALTWNNEIHCSFCETKQETAVRASISKAPKIIIFHLKRFDIQGTTKRKLRTDIHYPLTNLDLTPYICSIFRKYPKYNLCAVVNHFGDLDGGHYTAFCKNSVTQA Predict reactive species Full Name: ubiquitin specific peptidase 50 Calculated Molecular Weight: 339 aa, 39 kDa Observed Molecular Weight: 40 kDa GenBank Accession Number: BC146493 Gene Symbol: USP50 Gene ID (NCBI): 373509 RRID: AB_2923574 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q70EL3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.