Proteintech, 24835-1-AP, FOXD4 Polyclonal antibody

Size: 20ul / 150ul The FOXD4 (24835-1-AP) by Proteintech is a Polyclonal antibody targeting FOXD4 in WB, ELISA applications with reactivity to human, mouse, rat samples 24835-1-AP targets FOXD4 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: NIH/3T3 cells, Jurkat cells, RAW 264.7 cells, U-937 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information Forkhead box protein D4(FOXD4)also named as FKHL9 or Myeloid factor alpha is a 439 amino acid protein, which contains one fork head DNA-binding domain. FOXD4L6 localizes in the nucleus. FOXD4 as an embryonic transcriptional regulator involves in leukemogenesis. The molecular weight of FOXD4L6 is 47kDa, but our experiment always detected a 60-70kDa protein by western blot. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag19226 Product name: Recombinant human FOXD4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 361-439 aa of BC136570 Sequence: ILQQQQRHQEEDCANGCAPTKGAVLGGHLSAASALLRYQAVAEGSGLTSLAAPLGGEGTSPVFLVSPTPSSLAESAGPS Predict reactive species Full Name: forkhead box D4 Calculated Molecular Weight: 439 aa, 47 kDa Observed Molecular Weight: 65-70 kDa GenBank Accession Number: BC136570 Gene Symbol: FOXD4 Gene ID (NCBI): 2298 RRID: AB_2879750 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q12950 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.