Proteintech, 24905-1-AP, GRAMD1B Polyclonal antibody

Size: 20ul / 150ul The GRAMD1B (24905-1-AP) by Proteintech is a Polyclonal antibody targeting GRAMD1B in WB, IHC, IF/ICC, FC (Intra), ELISA applications with reactivity to human, mouse samples 24905-1-AP targets GRAMD1B in WB, IHC, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: A549 cells Positive IHC detected in: human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: A549 cells Positive FC (Intra) detected in: A549 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:20-1:200 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension Background Information GRAMD1B, also named as KIAA1201, contains a transmembrane region and two domains of known function; the GRAM domain and a VASt domain. It is predicted to localize in the nucleus, supported by several nuclear transport signals and nuclearly associated motifs. This highly conserved gene is found in a variety of vertebrates and invertebrates, however, it is not found in bacteria or fungi. There're some isoforms with MW 50 kDa and 81-87 kDa. With phosphor modification, it's about 90-110 kDa in WB detection. Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag20670 Product name: Recombinant human GRAMD1B protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 235-504 aa of BC107480 Sequence: YVPPDDDFNTMGYCEEIPVEENEVNDSSSKSSIETKPDASPQLPKKSITNSTLTSTGSSEAPVSFDGLPLEEEALEGDGSLEKELAIDNIMGEKIEMIAPVNSPSLDFNDNEDIPTELSDSSDTHDEGEVQAFYEDLSGRQYVNEVFNFSVDKLYDLLFTNSPFQRDFMEQRRFSDIIFHPWKKEENGNQSRVILYTITLTNPLAPKTATVRETQTMYKASQESECYVIDAEVLTHDVPYHDYFYTINRYTLTRVARNKSRLRVSTELRY Predict reactive species Full Name: GRAM domain containing 1B Calculated Molecular Weight: 738 aa, 85 kDa Observed Molecular Weight: 85 kDa GenBank Accession Number: BC107480 Gene Symbol: GRAMD1B Gene ID (NCBI): 57476 RRID: AB_2879791 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q3KR37 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.