Product Description
Size: 20ul / 150ul
The LCE1A (24956-1-AP) by Proteintech is a Polyclonal antibody targeting LCE1A in IHC, ELISA applications with reactivity to human samples
24956-1-AP targets LCE1A in IHC, ELISA applications and shows reactivity with human samples.
Tested Applications
Positive IHC detected in: human oesophagus tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0
Recommended dilution
Immunohistochemistry (IHC): IHC : 1:20-1:200
Background Information
late cornified envelope 1A (LCE1A), also named as LEP1, is a 110 amino acid protein, which belongs to the LCE family. LCE1A is a Precursor of the cornified envelope of the stratum corneum. LCE1A is detected in dult trunk skin, adult arm skin, fetal skin, penal skin, vulva, esophagus and tongue.
Specification
Tested Reactivity: human
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag21047 Product name: Recombinant human LCE1A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-41 aa of BC153155 Sequence: MSCQQSQQQCQPPPKCTPKCPPKCPTPKCPPKCPPKCPPVS Predict reactive species
Full Name: late cornified envelope 1A
Calculated Molecular Weight: 110 aa, 11 kDa
GenBank Accession Number: BC153155
Gene Symbol: LCE1A
Gene ID (NCBI): 353131
RRID: AB_2879820
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: Q5T7P2
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924